Protein Info for DVU2287 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: hydrogenase, CooK subunit, selenocysteine-containing, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 233 to 256 (24 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details PF00146: NADHdh" amino acids 20 to 316 (297 residues), 219.5 bits, see alignment E=3.5e-69

Best Hits

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 99% identity to dvl:Dvul_0968)

Predicted SEED Role

"Carbon monoxide-induced hydrogenase proton translocating subunit CooK" in subsystem Carbon monoxide induced hydrogenase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729R2 at UniProt or InterPro

Protein Sequence (321 amino acids)

>DVU2287 hydrogenase, CooK subunit, selenocysteine-containing, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQDILVALFHMIVFPGGAFALTLGLLLKGLDRKVEARLQRRVGPPIVQPFIDLVKLTTKE
TLIPATANRTFFLAAPLIGFTGMAVCAAFIPVPGVYDGMPGMGDMLVLFYLLPLPAIALM
VGGSASSSPFGAIGFSREMTMMLAYEIPLLAVLLAVALKVGHATGVGAELSLASVVAYQA
STGMLGLDPVMLPALLAYLLFLPGTAGVPPFDIPEAETEIIEGPLLEYSGPALGFFHLGA
ALKTVVVLGLGVAMFFPGTVPGGIVPNVLWFAAKUAGLMLLSLTLVKAATGRFRIDQAFT
FYLKLPTPLAMASLALAWLGF