Protein Info for DVU2281 in Desulfovibrio vulgaris Hildenborough JW710

Name: torS
Annotation: sensor histidine kinase/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 733 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details signal peptide" amino acids 24 to 24 (1 residues), see Phobius details PF02743: dCache_1" amino acids 40 to 202 (163 residues), 45.2 bits, see alignment E=1.8e-15 PF00512: HisKA" amino acids 352 to 417 (66 residues), 76.1 bits, see alignment E=3.5e-25 PF02518: HATPase_c" amino acids 463 to 578 (116 residues), 80.7 bits, see alignment E=2.2e-26 PF00072: Response_reg" amino acids 604 to 715 (112 residues), 88.6 bits, see alignment E=6.5e-29

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to dvu:DVU2281)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729R8 at UniProt or InterPro

Protein Sequence (733 amino acids)

>DVU2281 sensor histidine kinase/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MVRLRILTVVANIIVILLGAMTFREAWRNTLSNMEVASTNITVTLAERIGGYLDTLDVGL
LGLAGETRRHEGDNARQALPDVFSRFIDHLPLVDNLLYADASGEVVLDCNGLLQQRVHIG
DRVYFRNLRAGATRMEVSEPIEGRLSGKRVISVARRVTDGDGVFMGVVLATIPLERFSQL
FQGIDIGPNGHISFLRQGFIMLTRVPPLPPEMDVTPGRFGAQPVREAIQGGSEAGVVRTV
SHVGGLEKIFSYRKVGHHPFWVVVGLALDDAIQPWFRNAAYVAVIVVAFVVFTALSSRSL
RRALQQEVAARNAVERARNELETRVAERTALLEDSNLHLREAKEKADNANAAKSAFLANM
SHEIRTPLNGLLGMLDLLEATGLDAGQAEYLGMARRSGRRLTDLLGDILDLSRIEAGKLV
LAEQPFTLSDVLASIRETFAPLSREKGLPLEFALDAVPGPFLGDAVRVRQILLNLVGNAM
KFTNRGQMKLEVKTLLPMPDGRARILFMVHDSGCGIPEEQVGSICEPFTQVEAPLTKRYQ
GVGLGLAITRTLVHAYDGTLTVDSQVGVGTSVYLTLCLPLAAGDAKAAAPEVNPPQEDPQ
GLRVLVVEDDPVNLFTVRAMLERMGHTVRTATDGEQALAVLVGAPFDCVLMDIQMPQMDG
MTAVGLLRASHCANADVPVVALTAYVMNGDRERFLDASMDAYLAKPISMHALGEVLRHIP
LLRARRTGVTDGG