Protein Info for DVU2271 in Desulfovibrio vulgaris Hildenborough JW710

Name: pflA
Annotation: pyruvate formate-lyase activating enzyme, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02494: glycyl-radical enzyme activating protein
  • amino acids 6 to 289 (284 residues), 380.6 bits, E=2.4e-118
• PF13353: Fer4_12
  • amino acids 16 to 50 (35 residues), 22.8 bits, 5e-08
• PF12837: Fer4_6
  • amino acids 50 to 69 (20 residues), 29.8 bits, see alignment (E = 2e-10)
• PF00037: Fer4
  • amino acids 51 to 69 (19 residues), 31.4 bits, see alignment (E = 5.8e-11)
• PF13237: Fer4_10
  • amino acids 52 to 95 (44 residues), 31 bits, 9.5e-11
• PF12800: Fer4_4
  • amino acids 53 to 68 (16 residues), 18.8 bits, see alignment (E = 7.8e-07)
  • amino acids 82 to 95 (14 residues), 18.8 bits, see alignment (E = 7.8e-07)
• PF13187: Fer4_9
  • amino acids 55 to 97 (43 residues), 36.1 bits, 2.7e-12
• PF12838: Fer4_7
  • amino acids 55 to 98 (44 residues), 33.5 bits, 2.3e-11
• PF04055: Radical_SAM
  • amino acids 83 to 231 (149 residues), 65.3 bits, E=4.1e-21

Best Hits

Swiss-Prot: 41% identical to CUTD_DESAG: Choline trimethylamine-lyase activating enzyme (cutD) from Desulfovibrio alaskensis (strain G20)

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 100% identity to dvu:DVU2271)

MetaCyc: 41% identical to choline trimethylamine-lyase activating enzyme (Oleidesulfovibrio alaskensis G20)
RXN-16470

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

See Q729S8 at UniProt or InterPro

Protein Sequence (297 amino acids)

>DVU2271 pyruvate formate-lyase activating enzyme, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRQGMIYNIQRMSVHDGPGLRTTVFLKGCPLRCLWCSNPESQSAVPQMLFFENLCTGCGK
CVEVCPEGAARIVDGKVIRSIAKCTHCGLCTASCPSKAREMSGRLMTVEEVMDVVLKDML
FYENSGGGVTFGGGEPTSGGEFFLDLVKAAHEEGIHVTVDTCGFCPEERFDRTLALADLF
LFDCKHTDPEAHRRLTGQDNTLILRNLRAALASGKEVHVRMPLIPGMNDDDANLSALAAL
LGEFGRDKVEVMPCHAFGWNKYVALGLPAPDMPQYTPEQLSAVLDRFAKHGLVPVMV