Protein Info for DVU2259 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein TIGR01033 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 236 (236 residues), 326.1 bits, see alignment E=7.5e-102 PF20772: TACO1_YebC_N" amino acids 5 to 75 (71 residues), 105.8 bits, see alignment E=1.3e-34 PF01709: Transcrip_reg" amino acids 83 to 236 (154 residues), 222 bits, see alignment E=3.5e-70

Best Hits

Swiss-Prot: 100% identical to Y2259_DESVH: Probable transcriptional regulatory protein DVU_2259 (DVU_2259) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0986)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P62035 at UniProt or InterPro

Protein Sequence (247 amino acids)

>DVU2259 conserved hypothetical protein TIGR01033 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAGHSKWANIQHRKGRQDAKRGKMFTKAAKEIIIAAKAGGDPVGNSRLRAAIAAAKAINL
PKDKIENAIKKGTGELAGGDILEMAYEGYGPGGVALIVEVATDNKNRTVAEVRHILSKHG
GSMGESGCVAWMFDRKGVITLEKDKYTEEQLMEVALEAGAEDVTDEGESWEVVTAAADFN
AVREALEAAGVEMQSAEFTMVPQNEIEVDAETGRKLMRLVDALEDNDDVQNVHANFDLPD
ELLAELG