Protein Info for DVU2252 in Desulfovibrio vulgaris Hildenborough JW710

Name: dnaA-2
Annotation: chromosomal replication initiator protein DnaA (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF11638: DnaA_N" amino acids 3 to 61 (59 residues), 42.8 bits, see alignment 6.8e-15 PF00308: Bac_DnaA" amino acids 149 to 363 (215 residues), 188.4 bits, see alignment E=3.4e-59 PF08299: Bac_DnaA_C" amino acids 393 to 456 (64 residues), 72.3 bits, see alignment E=5.5e-24

Best Hits

Swiss-Prot: 100% identical to DNAA_DESVH: Chromosomal replication initiator protein DnaA (dnaA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to dvl:Dvul_0991)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729U6 at UniProt or InterPro

Protein Sequence (491 amino acids)

>DVU2252 chromosomal replication initiator protein DnaA (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTSIWGQIQHILQNTLAPGLFKVWISPLAGEVDGSTLRVEAPNEFVAGWVRDRLFEDIRT
AACGVIGDTVEVVVTAGAPAAAAPRPVLAPRPAVVEVVPTAAPVPSVVPAVEARPSGHAP
RRLSAETQQAQEQLGLPLDWAPVPQSRTNWRFSFDDFIVGPNNELACAAARGMCRDGLMT
DTLFLSSGPGLGKTHLLHAVGRSLCESSNRSNPNVAYLTAEEFASRLIAALKARDVERFK
ARYRDVDVLLLEDVHFLQGKEKMQDEVLATVKALQSRGSRIVFSSSFAARDLKNVDNQLV
SRFCSGFLAGIERPDFDTRRRILREKARIYQVMLPDNVTDLLAERISTDVRQIESCLHNL
ILKAKLLNRQISLEMAFEIIGNYAQAETQLDFEGIVRMVCEGFGLSPEQLNSRSRKREYV
VARNAAYLLARKHTDLSLKEIGDRFNRRHSTVLKGITALEREMNRETPLGRQVANTISLL
ERNGRITHARH