Protein Info for DVU2247 in Desulfovibrio vulgaris Hildenborough JW710

Name: ahpC
Annotation: alkyl hydroperoxide reductase C (Dmitry Rodionov)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00578: AhpC-TSA
  • amino acids 5 to 143 (139 residues), 108 bits, E=4.7e-35
• PF08534: Redoxin
  • amino acids 29 to 152 (124 residues), 50.3 bits, E=3.6e-17
• PF10417: 1-cysPrx_C
  • amino acids 164 to 197 (34 residues), 50.7 bits, 2e-17

Best Hits

Swiss-Prot: 56% identical to AHPC_HELPY: Alkyl hydroperoxide reductase C (ahpC) from Helicobacter pylori (strain ATCC 700392 / 26695)

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 100% identity to dvl:Dvul_0994)

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15

Sequence Analysis Tools

See Q729V1 at UniProt or InterPro

Protein Sequence (204 amino acids)

>DVU2247 alkyl hydroperoxide reductase C (Dmitry Rodionov) (Desulfovibrio vulgaris Hildenborough JW710)
MGVLVGKKAPFFEGGKTFSAVLGNGEVVDDFDFAKVTEGKYAVVFFYPLDFTFVCPSELI
AFDHRLEAFRQRNVEVIGVSIDSQFTHAAWRNTPVDKGGIGPVGYPLVADIQHELARAYD
VESEGGVAFRGSFLIDRAGVVQHQVVNNLPLGRDIDEMLRVVDALQFTEKHGEVCPAGWN
KGKKGMKPTADGVASYLAESAANL