Protein Info for DVU2246 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: S1 RNA binding domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 723 PF09371: Tex_N" amino acids 15 to 198 (184 residues), 212.3 bits, see alignment E=1.7e-66 PF16921: Tex_YqgF" amino acids 326 to 447 (122 residues), 142.3 bits, see alignment E=4e-45 PF14635: HHH_7" amino acids 460 to 553 (94 residues), 41.2 bits, see alignment E=6.6e-14 PF12836: HHH_3" amino acids 488 to 552 (65 residues), 97.4 bits, see alignment E=1.5e-31 PF17674: HHH_9" amino acids 558 to 627 (70 residues), 83.1 bits, see alignment E=7.2e-27 PF00575: S1" amino acids 646 to 717 (72 residues), 74.3 bits, see alignment E=2.9e-24

Best Hits

KEGG orthology group: K06959, uncharacterized protein (inferred from 100% identity to dvu:DVU2246)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729V2 at UniProt or InterPro

Protein Sequence (723 amino acids)

>DVU2246 S1 RNA binding domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTETIPHDSVAHRLAADLGITTAQASAALKLFDEGGTIPFVARYRKEATGGLDEVALTAL
RDGCERLRTLDKRRDAIIASMTEREQLTPDLAKALHAATTLTALEDIYLPFRPKRVTRAA
KARERGLAPLAERLLEQRGAQAGQLAAPFVDEAKGVPDTAAALAGARDIIAETVSEDRAT
RATLRDIFVRRATLRSKVARGKEEQAATYRDHFDRSEHAAAAPAHRLLAMFRGEREELLD
VRVRPDDDIAVGALHRRWLKGRASSAGTDAAEVATALTDAWNRLLAPSLENEFRTALRER
AEAEAIAVFAANLRELLLAPPMGPRRTLALDPGWRTGAKLVCLDAQGALLHHEVIHPLTG
GDRATRAAATLRELCTRHGIEAVAVGNGTAGRETEAFVKSAGLPPHVTVALVDERGASVY
SASEVARAEFPDHDVTVRGAISIGRRLMDPLAELVKVDPRSLGVGQYQHDVDQNALRRAL
EEVVASCVNAVGVDVNTASPELLAYVSGIGPALAKGIVALRAVNGPFRTRRDLLKVPRLG
PKAFEQAAGFLRVHGGPEPLDASAVHPESYAVVRRMAEDTGCSVPDLMRDATRREALRLE
RYVDDRVGLPTLRDIMSELARPGRDPRPAFEVFAFAEGVNKVDDVQPGMELPGIVTNVTK
FGAFVDIGVHRDGLVHVSQLADRFVRDPAEVVAPGRKVRVRVLDVDRQRERINLTLKGVP
QQD