Protein Info for DVU2245 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: mutT/nudix family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 PF00293: NUDIX" amino acids 6 to 130 (125 residues), 90.2 bits, see alignment E=5.9e-30

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 100% identity to dvu:DVU2245)

Predicted SEED Role

"ADP-ribose pyrophosphatase (EC 3.6.1.13)" in subsystem NAD and NADP cofactor biosynthesis global or Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.13)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729V3 at UniProt or InterPro

Protein Sequence (138 amino acids)

>DVU2245 mutT/nudix family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MYRNPAPTVDVVIHAPGRGIVLVERRNEPHGWALPGGFIDYGESAEDAAVREAREETGLA
VTLEGLVGVYSDPARDPRHHTMSVVYAARIAKGTGSEPHAGDDAAQARFFSPDALPQPIA
FDHATIIADFLRRNRGAV