Protein Info for DVU2244 in Desulfovibrio vulgaris Hildenborough JW710

Name: glgA
Annotation: glycogen synthase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 PF08323: Glyco_transf_5" amino acids 4 to 243 (240 residues), 272.1 bits, see alignment E=7.4e-85 TIGR02095: glycogen/starch synthase, ADP-glucose type" amino acids 4 to 480 (477 residues), 520.9 bits, see alignment E=1.4e-160 PF00534: Glycos_transf_1" amino acids 299 to 443 (145 residues), 70.2 bits, see alignment E=2.4e-23 PF13692: Glyco_trans_1_4" amino acids 300 to 441 (142 residues), 67.3 bits, see alignment E=2.7e-22

Best Hits

Swiss-Prot: 100% identical to GLGA_DESVH: Glycogen synthase (glgA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00703, starch synthase [EC: 2.4.1.21] (inferred from 100% identity to dvl:Dvul_0998)

Predicted SEED Role

"Glycogen synthase, ADP-glucose transglucosylase (EC 2.4.1.21)" in subsystem Glycogen metabolism (EC 2.4.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729V4 at UniProt or InterPro

Protein Sequence (489 amino acids)

>DVU2244 glycogen synthase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQRQVVFATSEMYPFSKSGGLGDVLGALPLALHRMGVPTAVVTPFYGRLRTADYPIRLTV
SDCHVGYPWAPITCDVFEADYHGMPVYFIHRGEYFDRRYYYNDHKGDYFDNCERFVFFCR
ALLALMRRLGQPPAVLHAHDWQTALVPAFLYFLRQTDPFWQDTRSVLTIHNLAFQGRFAS
RLFETSGLPPQAWSVDGAEFWGDFNLLKAGIAYADKVTTVSPSYAREILGPAYGSGLDGI
LRKRAHALHGILNGADYDIWSPGNDRFLPCRYTPTDLAGKAQCKRALIEELGLDPHLARR
PILGFIGRLRGQKGIDLLLDILPRLMESDVGVIILGEGNLTHEARALELMEAYRGRVCTI
VSYTEDLAHRIQAGSDIFLMPSRYEPCGLTQMYALRYGTPPVATAVGGLRDTIVPWPSPE
STGFTFGRCESAAFLRAILDAVHLWTTAPGDWQGMVRRAMAQAFTWERAGRAYLDLYAQL
GVSPGEEGA