Protein Info for DVU2241 in Desulfovibrio vulgaris Hildenborough JW710

Name: pdxA
Annotation: pyridoxal phosphate biosynthetic protein PdxA (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 159 to 399 (241 residues), 307.6 bits, see alignment E=5.7e-96 PF04166: PdxA" amino acids 160 to 397 (238 residues), 314.4 bits, see alignment E=3.7e-98

Best Hits

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 100% identity to dvu:DVU2241)

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q3V890 at UniProt or InterPro

Protein Sequence (406 amino acids)

>DVU2241 pyridoxal phosphate biosynthetic protein PdxA (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MVDHFSHKPVAPLCVTLGDSNGLGPELACRLLGEVVRRSTDANTSPPEKGAGASARDICT
SASAPDVCADGAGLQKEATAPLTTGAAQPDTSPDADTARHAAALLPFLAGRTVLCIGAEA
SLFAHTRKAFWTRVDTPGDALAAGPGIYLYEPPGLDGLDVRVGEATVSGGRAAGVALSAA
CDLLCAGVVPGVVTLPLHKAMLHTAGFDVPGHTEYLARRAGLADDEVCMHLCGDRLRVSL
VTTHPPLREVADLVTRERVLRCLRLTAAFVRALGLQGPVAVCGLNPHAGESGRIGREEIE
VITPAIEDARREGLAVEGPFPADTLFHRAAGGGYPAVLAMYHDQGLGPLKLLHFSDAVNV
TLGLPFVRTSVDHGTGFDIAGTGRASTGSFTAALQLACMLCDAKGR