Protein Info for DVU2239 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: glycosyl hydrolase, family 3 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details PF00933: Glyco_hydro_3" amino acids 56 to 390 (335 residues), 221.7 bits, see alignment E=8.8e-70

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1003)

Predicted SEED Role

"Beta-hexosaminidase (EC 3.2.1.52)" in subsystem Chitin and N-acetylglucosamine utilization or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 3.2.1.52)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729V8 at UniProt or InterPro

Protein Sequence (481 amino acids)

>DVU2239 glycosyl hydrolase, family 3 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTVPVVPGYCSSPCGGLSPQRHNRGGLRWLASTFAVLLALCLTVASAQCASANATVEAMA
GQMLMLGFRGAEPADAGPILRSIAAGHVGGVILFDRDMDPSVRVRNIVSKEQLSRLTGAL
QAAAPVPLFIAVDQEGGRVRRLKPEYGFFAYPSAASLGKGSPEDTRRMASTLATEMAEVG
LNVDFGPVVDLAVNPSNPVIARLERSYGSDPCRVASHAAAFVNGLAWRGVVASLKHFPGH
GSSLQDSHLGVTDISSTWRREELGPYALLLRDDWAGMVMVGHLYNNRIDAAHPATLSQRT
IDGLLRRDLGWKGVVVTDDLQMGAITARYSLDETVRLAVEAGADILLFGNNLVWDEGLAE
KVHATLVRLVREGKVSEQRLRQSWERIMRLKSVLTVASPGAIAQGDSSGTAIAPVPAVPD
PTGAPRPLRLTLPMPRGDEPLCRDRDTLQRDPFDDRQGARYGRGTGIGIGVGTGTGIGIG
Q