Protein Info for DVU2233 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF12146: Hydrolase_4" amino acids 65 to 275 (211 residues), 36.6 bits, see alignment E=6.4e-13 PF00561: Abhydrolase_1" amino acids 69 to 302 (234 residues), 59.8 bits, see alignment E=6.8e-20 PF02129: Peptidase_S15" amino acids 80 to 287 (208 residues), 24.2 bits, see alignment E=5.1e-09 PF12697: Abhydrolase_6" amino acids 93 to 304 (212 residues), 37.3 bits, see alignment E=9.5e-13

Best Hits

KEGG orthology group: K07019, (no description) (inferred from 99% identity to dvl:Dvul_1008)

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729W4 at UniProt or InterPro

Protein Sequence (325 amino acids)

>DVU2233 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPLLPSSYRCPPLLHNPHVQTMFPVLFRPHPEVSYRRIRIETEDGDFFNLDTLTARPDGQ
RGDRVAIVSHGLEGDTGRKYMTGMARALLESGWDVAARNFRGCGGEDNRLLPMYHSGQTI
DVAAAVAWCVAQGYGRVVLVGFSMGGNQTLKYLGEDAASVPSQVTGAAVFSVPCDLVGAA
AVLDRPSNAVYMAYFMRMLRPKMRLKAQRFPGEVDVSGLETMRTFREFDERFTAPLHGFS
SALDYWTRASCAPHLAAIRVPTLVVNALDDPFLSPSCFPWDEAVTNDALTLEVPLHGGHV
GFVSMNRHNRYWAESRAVSFFSGLA