Protein Info for DVU2226 in Desulfovibrio vulgaris Hildenborough JW710

Name: accC
Annotation: acetyl-CoA carboxylase, biotin carboxylase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF00289: Biotin_carb_N" amino acids 6 to 115 (110 residues), 112.8 bits, see alignment E=1.8e-36 PF02786: CPSase_L_D2" amino acids 120 to 351 (232 residues), 103.8 bits, see alignment E=1.5e-33 PF02785: Biotin_carb_C" amino acids 366 to 448 (83 residues), 47.2 bits, see alignment E=3.2e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2226)

Predicted SEED Role

"Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.3.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729X1 at UniProt or InterPro

Protein Sequence (471 amino acids)

>DVU2226 acetyl-CoA carboxylase, biotin carboxylase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQTNDHKVLVANRGEIATRIVRACHRLGLEFTCVYTAEDAASGHVRLARELGGANSLYRV
SSYHDANELLAVADDAGCTAVHPGYGFFAEDYRFARRVAQRERKLIFIGPSWRVIRELGD
KINTKRLARSLGVPTVPGSDKPIYDELEAEKVAQSLYEFQEQQGIRRPLVLVKASAGGGG
MGIEEVYDLDLFKSVYRRIRNYALRQFKDEGVLIEQRIRDFNHLEVQIVSDRTGRNPVHF
GTRNCSIQSIGLQKRIEVAPGFDPTSIEYGFDAAQVLRDITYHSLAMARKVGYDNVGTWE
WIVTRDGHPFLMEVNTRIQVENGVSARIARVNGQEVDLIAEQIRIGLGQPLGYGQEDITF
EGVGIEYRLIAEDPDNRFTPWVGRIDAFGWPEEDWARMYTHVPTEEPYDIPTEFDPNLAL
AIIWGKDLEEVKRRGVSFLEGLTLQGQNKAGDELRSNVNFLRDNTGRILRF