Protein Info for DVU2210 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: TPR domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 TIGR00702: YcaO-type kinase domain" amino acids 20 to 294 (275 residues), 105.6 bits, see alignment E=1.5e-34 PF02624: YcaO" amino acids 74 to 382 (309 residues), 209.3 bits, see alignment E=2.9e-65 PF14559: TPR_19" amino acids 506 to 561 (56 residues), 28.5 bits, see alignment 4.6e-10 PF13181: TPR_8" amino acids 533 to 560 (28 residues), 19.7 bits, see alignment (E = 2.2e-07)

Best Hits

KEGG orthology group: K09136, ribosomal protein S12 methylthiotransferase (inferred from 100% identity to dvl:Dvul_1028)

Predicted SEED Role

"TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729Y7 at UniProt or InterPro

Protein Sequence (575 amino acids)

>DVU2210 TPR domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIQLRPCPKSYTRDQDKATTPAETVRRVRERLASLDISILAETRRVDVGRLGIPVFLSVC
GADARAVMPTRKQMGKGASLEQAQASALMELMERYSFFTFWRDMPGMVEATWSEARNRFG
DALIPVDEILHSVHDTLSPDDAVRALDLWRWKFFPATDITHGREVWLPLDWFKKLGEFNG
SSAGNTEEESILQGSCELVERHVCCLIDRTQPELPTIDPASLDDPVLLELAAAFERNGIR
LVLKDFSMGMPVPTVGAIAWDPATFPERSEIVYTAGTSSSPVKAAIRAVTEVAQLAGDFC
TGACYEASGLSKYESLDDIAWLVAGPVVALDTLPSVETDDIRDELAALCDGLAATGHTLY
SVSTMNPDVGVNTHYNIVPGFHFRERDRNASLGLFIGRILSEEADAGTALAGLSVLEELY
PGAHFLPFFKGMLALRAESHHEAISFFEQAEPLQPEADSRGLAAFYGAYVRTLLTDWQGA
LPGLDRAVTECPEMKEYFNLRGVCHFKLGDYAQAAQNFAQVLHIDKGAVVDLANLGLCHK
FMGDTEKAEELLSAALEIDPGLDFARRHLDEMRQP