Protein Info for DVU2166 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: holin (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details TIGR01593: toxin secretion/phage lysis holin" amino acids 10 to 122 (113 residues), 62.1 bits, see alignment E=2.5e-21 PF05105: Phage_holin_4_1" amino acids 11 to 125 (115 residues), 101.4 bits, see alignment E=1.8e-33

Best Hits

KEGG orthology group: None (inferred from 98% identity to dvl:Dvul_1067)

Predicted SEED Role

"Holin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72A31 at UniProt or InterPro

Protein Sequence (132 amino acids)

>DVU2166 holin (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKASIGTCAAFVGTLLGGVGMMISLLFLLLVIDFALGFCRAWRAGRVSSSKLRGGGLKFV
FYFLSIVVMAAVQAATSQSTGMTIPLRDVFVAYLCVNEGLSCLEHLSYFGVPVPEKIRER
LRAYRDNLCTSK