Protein Info for DVU2150 in Desulfovibrio vulgaris Hildenborough JW710

Name: dksA
Annotation: dnaK suppressor protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 TIGR02420: RNA polymerase-binding protein DksA" amino acids 1 to 109 (109 residues), 151.3 bits, see alignment E=5.8e-49 PF21157: DksA_N" amino acids 6 to 75 (70 residues), 84.2 bits, see alignment E=6.3e-28 PF01258: zf-dskA_traR" amino acids 78 to 112 (35 residues), 52.5 bits, see alignment E=3.8e-18

Best Hits

Swiss-Prot: 42% identical to DKSA_CAUVN: RNA polymerase-binding transcription factor DksA (dksA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K06204, DnaK suppressor protein (inferred from 100% identity to dvu:DVU2150)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72A47 at UniProt or InterPro

Protein Sequence (120 amino acids)

>DVU2150 dnaK suppressor protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEQKDIEYFRQLLASMLDEAQQKGDSTLEDLTDNNEIFADPADRATAESDRAFTLRIRDR
ERRLIKKIRAAIQRIDDGSFGVCDECGEEIGVPRLKARPVTKLCINCKSKQEEDEHLRGD