Protein Info for DVU2148 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: CBS/transporter associated domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details PF01595: CNNM" amino acids 11 to 197 (187 residues), 155.3 bits, see alignment E=2.2e-49 PF00571: CBS" amino acids 217 to 272 (56 residues), 20.9 bits, see alignment 5.8e-08 amino acids 283 to 336 (54 residues), 32.4 bits, see alignment 1.4e-11 PF03471: CorC_HlyC" amino acids 352 to 429 (78 residues), 79.3 bits, see alignment E=2.6e-26

Best Hits

Swiss-Prot: 44% identical to Y260_SYNY3: UPF0053 protein sll0260 (sll0260) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K03699, putative hemolysin (inferred from 100% identity to dvu:DVU2148)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72A49 at UniProt or InterPro

Protein Sequence (464 amino acids)

>DVU2148 CBS/transporter associated domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSTSFVGEGFAILLLILLNGFFALAEMSLVTSRKPRLEAEAARGNRGAAVALRLLETPDS
LFSTVQIGITLIGILTGAFGGASVAAHLTHVLADMPAVAPYAASLAFGVVIIVTTYLTLI
FGELVPKKMAFASPERFACAVAPVMLVFMRLSMPAVWLLSLSSRAASTILRIREDGPSVT
DEDIRGMLAEGVRSGVVLDAERTMSERVMRLGDRSVTSIMTHRTRVAWLDSEAPQEDIIE
RLAASTYSRFPVCDGDLDNVLGVIKAREYLAACAEGADVTLKNFMRQPVFIPETARALDL
LEAFRTTPHVHFAMVVGEYGEVQGIVTLNDVLEAIVGDIPSPDEADEPEAVRRADGSWLL
DGMMHIDDMADVTGLRLPDEKHGDFETLAGLLLQHLGKLPAIGDTLRLGPLHFEIVDMDG
RRIDRVLLSTAATVKDEYAPGTDTAAQKSATDAAPSKGGSNPAA