Protein Info for DVU2147 in Desulfovibrio vulgaris Hildenborough JW710

Name: sda
Annotation: L-serine dehydratase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03315: SDH_beta
  • amino acids 13 to 95 (83 residues), 95.3 bits, E=4.9e-31
  • amino acids 155 to 206 (52 residues), 28.4 bits, 2e-10
• TIGR00720: L-serine ammonia-lyase
  • amino acids 154 to 499 (346 residues), 346.5 bits, E=1.3e-107
• PF03313: SDH_alpha
  • amino acids 233 to 496 (264 residues), 245.2 bits, E=9.2e-77

Best Hits

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 100% identity to dvu:DVU2147)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-serine degradation (3/3 steps found)
• L-tryptophan degradation II (via pyruvate) (3/3 steps found)
• D-serine degradation (2/3 steps found)
• L-cysteine degradation II (2/3 steps found)
• glycine degradation (2/3 steps found)
• L-methionine biosynthesis II (4/6 steps found)
• glycine betaine degradation III (4/7 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (2/8 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

See Q72A50 at UniProt or InterPro

Protein Sequence (502 amino acids)

>DVU2147 L-serine dehydratase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQPLVPCSAIAISLFDLFEAGPGPSSSHTIGPMKAGYDFAQRCATLPDDILCRAAGVRVR
LFGSLSATGYGHGTDMAVLAGLAGQLPASCPPEYLVRPEGAGEERPATDTTLADGRYASL
LGCEGVVPVPVAGQGQGHSASGAVVRYMMLRDGLRLPLTSACVVHDAVQHEHPFSNTLVL
ELLGDTGASLFSYTYYSVGGGFIQWEGWQPEERGAPVHPYCTMRQLRECMDDTGLALHEI
ILENEMAVTGASRASIVARLDTIIGLMEASVERGLATTGRLPGTLGVFRKASTLMARAGK
LPHAVDAFLCRLNAYAFAVSEENASGGVIVTAPTCGAAGVMPAVLYAMRNDFSIGDRAVR
EGVLASAAVGFLAKQNAGIAGAEVGCQGEVGVASAMAAAMLAHARGNAVRVVENAAEIAL
EHHLGLTCDPVGGYVQIPCIERNAVGAVKAYNACLVATCEDPKHHRVTLDNVIRAMAEIG
HDMNAKFKETSAGGLAVSVVEC