Protein Info for DVU2147 in Desulfovibrio vulgaris Hildenborough JW710

Name: sda
Annotation: L-serine dehydratase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03315: SDH_beta" amino acids 13 to 95 (83 residues), 95.3 bits, see alignment E=4.9e-31 amino acids 155 to 206 (52 residues), 28.4 bits, see alignment 2e-10 TIGR00720: L-serine ammonia-lyase" amino acids 154 to 499 (346 residues), 346.5 bits, see alignment E=1.3e-107 PF03313: SDH_alpha" amino acids 233 to 496 (264 residues), 245.2 bits, see alignment E=9.2e-77

Best Hits

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 100% identity to dvu:DVU2147)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72A50 at UniProt or InterPro

Protein Sequence (502 amino acids)

>DVU2147 L-serine dehydratase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQPLVPCSAIAISLFDLFEAGPGPSSSHTIGPMKAGYDFAQRCATLPDDILCRAAGVRVR
LFGSLSATGYGHGTDMAVLAGLAGQLPASCPPEYLVRPEGAGEERPATDTTLADGRYASL
LGCEGVVPVPVAGQGQGHSASGAVVRYMMLRDGLRLPLTSACVVHDAVQHEHPFSNTLVL
ELLGDTGASLFSYTYYSVGGGFIQWEGWQPEERGAPVHPYCTMRQLRECMDDTGLALHEI
ILENEMAVTGASRASIVARLDTIIGLMEASVERGLATTGRLPGTLGVFRKASTLMARAGK
LPHAVDAFLCRLNAYAFAVSEENASGGVIVTAPTCGAAGVMPAVLYAMRNDFSIGDRAVR
EGVLASAAVGFLAKQNAGIAGAEVGCQGEVGVASAMAAAMLAHARGNAVRVVENAAEIAL
EHHLGLTCDPVGGYVQIPCIERNAVGAVKAYNACLVATCEDPKHHRVTLDNVIRAMAEIG
HDMNAKFKETSAGGLAVSVVEC