Protein Info for DVU2143 in Desulfovibrio vulgaris Hildenborough JW710

Name: fba
Annotation: fructose-1,6-bisphosphate aldolase, class II (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00167: ketose-bisphosphate aldolase
  • amino acids 6 to 306 (301 residues), 313.2 bits, E=1.7e-97
• TIGR01859: fructose-1,6-bisphosphate aldolase, class II
  • amino acids 7 to 307 (301 residues), 362.7 bits, E=1.7e-112
• PF01116: F_bP_aldolase
  • amino acids 7 to 306 (300 residues), 354.9 bits, E=1.8e-110

Best Hits

Swiss-Prot: 49% identical to ALF_THECA: Fructose-bisphosphate aldolase (fba) from Thermus caldophilus

KEGG orthology group: K01624, fructose-bisphosphate aldolase, class II [EC: 4.1.2.13] (inferred from 100% identity to dvu:DVU2143)

Predicted SEED Role

"Fructose-bisphosphate aldolase class II (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

• homolactic fermentation (11/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• pentose phosphate pathway (non-oxidative branch) II (6/6 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• glycolysis IV (8/10 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• gluconeogenesis I (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
• sedoheptulose bisphosphate bypass (1/2 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (18/26 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• oxygenic photosynthesis (11/17 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (14/22 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (15/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (14/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13

Use Curated BLAST to search for 4.1.2.13

Sequence Analysis Tools

See Q72A54 at UniProt or InterPro

Protein Sequence (307 amino acids)

>DVU2143 fructose-1,6-bisphosphate aldolase, class II (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPLTGPREMFARAYREGHAVGAFNVNNMEIIQGIMQAGAEERAPLILQVSAGARKYAGQN
YIIKLIEAALLDTDLPVVLHLDHGQDFDICKSCIDGGFTSVMIDGSHLSYEENIAVTRRV
VEYAHDKGVWVEAELGQLAGVEDEVSAEHSVYTDPDQAVEFVQRTGCDSLAIAIGTSHGA
YKFTGDAKLDFARLETITKMLPDYPLVLHGASSVPQEFVEMANAYGGKVGGARGVPEDLL
RKAATFGVCKINIDTDIRLAMTATIRKHFIENPGDFDPRAYLKPAREAVKNMVQHKIRNV
LGCSNKI