Protein Info for DVU2137 in Desulfovibrio vulgaris Hildenborough JW710

Name: sucCD
Annotation: succinyl-CoA synthetase, alpha/beta subunit (sucCD) (Chris Hemme)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 709 transmembrane" amino acids 321 to 337 (17 residues), see Phobius details PF08442: ATP-grasp_2" amino acids 21 to 206 (186 residues), 104.1 bits, see alignment E=2e-33 PF00549: Ligase_CoA" amino acids 266 to 361 (96 residues), 66.8 bits, see alignment E=5.4e-22 amino acids 571 to 674 (104 residues), 61.9 bits, see alignment E=1.8e-20 TIGR01019: succinate-CoA ligase, alpha subunit" amino acids 425 to 707 (283 residues), 357.2 bits, see alignment E=3.4e-111 PF02629: CoA_binding" amino acids 428 to 518 (91 residues), 86 bits, see alignment E=6.1e-28 PF13380: CoA_binding_2" amino acids 446 to 547 (102 residues), 23.2 bits, see alignment E=2e-08 PF13607: Succ_CoA_lig" amino acids 564 to 671 (108 residues), 32.3 bits, see alignment E=2e-11

Best Hits

KEGG orthology group: K01902, succinyl-CoA synthetase alpha subunit [EC: 6.2.1.5] (inferred from 100% identity to dvu:DVU2137)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72A60 at UniProt or InterPro

Protein Sequence (709 amino acids)

>DVU2137 succinyl-CoA synthetase, alpha/beta subunit (sucCD) (Chris Hemme) (Desulfovibrio vulgaris Hildenborough JW710)
MFVRSVIAFATPNPTGLTMFLNEHQSKRLFEEAGIETPQGIMTDSAGIEGCLPPFDAPWF
VKAQVLAGGRGKAGGVRRADDLAGLRDVAKDILGMRIGGHAVPFVRIEPATAIARECYVS
FMVSRKRRELLFTASGSGGVEVESGQGALVCAVPLTGEMPEHVIRSAFFCIGVGREHWAG
FREFVLRLHGAVRDYGLLLAEVNPLVLTGDGRWLALDGKVEVDDNVVDIRPDLLRFHTPE
HLAPEENAAREAGLSYVELKGWVGLLVNGAGLAMATMDLLNFSGLAAANFMDLGGAADVP
RMRRALELLFGNPQVRVVCVNLFGGIVSCAAVAGALVEALGDGRAAKPVVVRMDGFEAAE
GRQLLERRAHPDVHVARDIDHALDLLRHLRPADAPDIVFTPGTEKPVPRIHGGAAGTRRG
TPHLGKGARVLVQGITGRSAQLHTRLMLDYGTNIVAGVTPFKGGQVTQGVPVYDSVHEAC
RQHDIDATILFVPAAFAADSLLEAVAEGIPWAVCITEGIPQKDMLRALRVARGARTRIIG
PNTPGIIVPGACKVGIMPGNVFSPGPLAVFSRSGTLTYEAAARLSAAGIGQSLCAGVGGD
PYIGSDFVSLCELVRDDEATQGVLVLGEVGGTAEEELAAWVRETAFPKPVVSFVAGRTAP
PGRRLGHAGAILDEADGGIAGKVRALCDAGIAVCPDLGSLPAAVRQALG