Protein Info for DVU2119 in Desulfovibrio vulgaris Hildenborough JW710

Name: cpaC
Annotation: type II/III secretion system protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF13629: T2SS-T3SS_pil_N" amino acids 40 to 110 (71 residues), 76.6 bits, see alignment E=1.5e-25 PF04972: BON" amino acids 114 to 173 (60 residues), 32 bits, see alignment E=1.9e-11 PF00263: Secretin" amino acids 258 to 416 (159 residues), 150.9 bits, see alignment E=4.1e-48

Best Hits

KEGG orthology group: K02280, pilus assembly protein CpaC (inferred from 100% identity to dvu:DVU2119)

Predicted SEED Role

"Type II/IV secretion system secretin RcpA/CpaC, associated with Flp pilus assembly" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72A78 at UniProt or InterPro

Protein Sequence (484 amino acids)

>DVU2119 type II/III secretion system protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTSRTAPSAYDASTLLFTLLCTIALSCAALTVPTFCGAASSELQVATGKSSVVSTSRPVG
RLAIADEAIAGVVVLSPQQVYVTGKKAGTTTLTLWDGGGAVIGVYDVQVTPDIAQLKEML
HRVLPGENDIMVMGVNDTVTLAGTVRSAASMTTAMDMARLYAPDKVTNLMQVGGVHQVML
EVKVAEMRRNVMERLGIDLTYAWRGDFIFGMLNQLFTLDSQKGVVDAGPSGAVLSPNVNG
AFRITSGQVSIMGFLDVLKQNGLVKVLAEPTLVCRSGEKAEFLAGGEIPIPVPQGLGTVA
IEYKEFGVTLQFLPTVVGDGRISMKVAPEVSELDYTNVVQIQGFTIPAITSRRASTTVEL
ADGQSFAIAGLLRDDVRQAVNKYPVLGDMPVLGTLFRSSNWQKNETELVIIVTPHLAKPL
EANATRLPTDAYREPSAFEYFILGRMEGSRRADATAAAARTYGTTGAGAPSGMEGAFGHM
LPAR