Protein Info for DVU2114 in Desulfovibrio vulgaris Hildenborough JW710

Name: atoC
Annotation: sigma-54 dependent transcriptional regulator/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF00072: Response_reg" amino acids 5 to 112 (108 residues), 93.3 bits, see alignment E=3.9e-30 PF00158: Sigma54_activat" amino acids 143 to 307 (165 residues), 226.9 bits, see alignment E=4.4e-71 PF14532: Sigma54_activ_2" amino acids 144 to 314 (171 residues), 52.4 bits, see alignment E=2.4e-17 PF01078: Mg_chelatase" amino acids 164 to 290 (127 residues), 21.3 bits, see alignment E=5.5e-08 PF07728: AAA_5" amino acids 167 to 287 (121 residues), 31.1 bits, see alignment E=8e-11 PF25601: AAA_lid_14" amino acids 315 to 389 (75 residues), 78.6 bits, see alignment E=8.9e-26 PF02954: HTH_8" amino acids 408 to 449 (42 residues), 48.5 bits, see alignment 2e-16

Best Hits

Swiss-Prot: 40% identical to ALGB_PSEPK: Alginate biosynthesis transcriptional regulatory protein AlgB (algB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1117)

Predicted SEED Role

"sigma-54 dependent transcriptional regulator/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72A83 at UniProt or InterPro

Protein Sequence (462 amino acids)

>DVU2114 sigma-54 dependent transcriptional regulator/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKGHILLIEDDTAFQGMLREALEERGYRVTAVNRAEDGVRIVRSGDFDLVLTDVMLPGIS
GVEAIPRLREAAPGTDIVVMTAFSTRELALEAVKLGAYDFFSKPFSLKELDIVIRRAMEK
RRMQGEIVALRETLRRDTPTSRIVGESRAMRDVKALLERIAPLESTVLIMGESGTGKELI
ADTIRALSPRAANPFVKVNCAAIPEHLFENELFGHEKGAFTGAATAMPGKFEQAQGGMIM
LDEIGDMPLAIQPKLLRVVEQKQVERLGGRAPVPLDVRIIAATNQNLAERVREKAFREDL
YYRLSVAVVLIPPLRDRKDDIPLLAQYFVNKLEGTLGLPVHGLSPDAIAVLMDHDWPGNV
RQLANVLERAAIAADGLICARDVMAAIGTARGSNVDKATLSGMDLKTTLRMVERNLILDA
LRRCHGRQTEAAVLLGLTPKNLWAKLRKHGIRAGTEDLLQQT