Protein Info for DVU2113 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: xanthine/uracil permease family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 92 to 121 (30 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 384 to 412 (29 residues), see Phobius details amino acids 423 to 440 (18 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 25 to 402 (378 residues), 161.8 bits, see alignment E=1.1e-51

Best Hits

Swiss-Prot: 52% identical to Y326_METJA: Putative permease MJ0326 (MJ0326) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 100% identity to dvl:Dvul_1118)

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72A84 at UniProt or InterPro

Protein Sequence (443 amino acids)

>DVU2113 xanthine/uracil permease family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MMAGAAGVLERLFRIREKGSTVRTEILGGITTFVAVSYIIFVNPSILADAGIPKEAAIAS
TIWAATATTLLMGLWANFPVAVAPGMGLNAFFAYYVCGVLGLPWQVALGAVFISGVIFLL
LTVTRVRQIIIDAVPMNLKCSIVVGIGLFIAFIGLKSAGIVVSNPATFVTTGNLAKAEPL
LACTGLILTAVLMARNVRGAILIGILVTTGLGMAVGAVPMPTGMDSVMSFNLPSLTPTLM
QLDIMGAIKYGLFSILFTFTIVDLFDNMGTLIGLSRKAGLMDDKGHIPNLDKALVTDSVG
TVLSSFLGTSTVTSYVESAAGIAEGARTGLAAVVTAILFMFALVFAPLVGLVPAFATAPA
LVIVGALMMMEVRHVDFTDFTEAFPAFMTIVMMPLTFSIASGFGFGFISYAFVKTCSGRA
REVSPVMWLIAIAFIFNFALRSH