Protein Info for DVU2106 in Desulfovibrio vulgaris Hildenborough JW710

Name: flrC
Annotation: sigma-54 dependent transcriptional regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF13188: PAS_8" amino acids 10 to 60 (51 residues), 30.2 bits, see alignment 9.5e-11 PF00989: PAS" amino acids 10 to 117 (108 residues), 47.9 bits, see alignment E=3.7e-16 TIGR00229: PAS domain S-box protein" amino acids 11 to 128 (118 residues), 53.4 bits, see alignment E=1.4e-18 PF08448: PAS_4" amino acids 14 to 122 (109 residues), 55.6 bits, see alignment E=1.8e-18 PF13426: PAS_9" amino acids 18 to 120 (103 residues), 64.3 bits, see alignment E=3.2e-21 PF00158: Sigma54_activat" amino acids 137 to 303 (167 residues), 225.4 bits, see alignment E=1.1e-70 PF14532: Sigma54_activ_2" amino acids 139 to 308 (170 residues), 78.4 bits, see alignment E=1.9e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2106)

Predicted SEED Role

"sigma-54 dependent transcriptional regulator/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72A91 at UniProt or InterPro

Protein Sequence (458 amino acids)

>DVU2106 sigma-54 dependent transcriptional regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MALPRDIPCETIMESVADGVFTVDLDWRITSFNRAAAAITGVPAEEALGRRCRDVFHSSV
CDGACVLRACMEQDTPFGSRTVFMVRTDGTRVPVSISAAPLKDRRGRLIGGVETFRDLTA
LHLMRRELEGQRTVEDIVTRSHAMTRLLDLLPQIAASDAPVLILGESGTGKELFARALHN
LSPRAAKPFVGVNCGALPENLLESELFGYKAGAFTDARRDKPGRFHTAGDGTIFLDEIGD
MPLPLQVKLLRVLQEKCFEPLGAVNAEPALARVIAATNRDLERMTAEGTFRTDLYYRLNV
VLLRLPPLRERPEDVPALIDHCVRRRNLLTGKDIEGVSEDVLHLMLRYPFPGNVRELDNI
IEYAFILCGHGFIQLEHLPEYLLHAGGIATPSLAPSRPQPRPAGEPGDDGQPATLEAIKY
RAVVDALARNNGRRMATCRELDISKDTLRRILQRGDTK