Protein Info for DVU2103 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: iron-sulfur cluster-binding/ATPase domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF01656: CbiA" amino acids 5 to 224 (220 residues), 32.9 bits, see alignment E=2.2e-11 PF13237: Fer4_10" amino acids 62 to 107 (46 residues), 27.5 bits, see alignment 9.9e-10 PF00037: Fer4" amino acids 63 to 83 (21 residues), 23.5 bits, see alignment (E = 1.5e-08) amino acids 90 to 110 (21 residues), 26.1 bits, see alignment (E = 2.3e-09) PF12838: Fer4_7" amino acids 67 to 110 (44 residues), 30.4 bits, see alignment 1.7e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1128)

Predicted SEED Role

"MinD superfamily P-loop ATPase containing an inserted ferredoxin domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72A94 at UniProt or InterPro

Protein Sequence (287 amino acids)

>DVU2103 iron-sulfur cluster-binding/ATPase domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKQFVVISGKGGTGKTSVTAGLAAVGKDMVLADCDVDAADLHLVLAPEIRERHDFISGVV
ASIEPEACISCGLCTTHCRYGAIPQGYAPQVAPEHCEGCGVCAHVCPTGAARLSDRRCGE
WYVSDTRFGPMVHAALGIGEENSGKLVSTVRTRARELAEARDASVVLIDGSPGVGCPVIA
SLAGADAALAVTEPTVSALHDLERVHALARHFDVRMAVLLNKADIHPGMAERIIGYCTTH
DLPLVGRFGFSPLFVQAQLEGRTLPEQDSGEWRQRFNGVWNQLLALV