Protein Info for DVU2088 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details PF00892: EamA" amino acids 7 to 140 (134 residues), 68.6 bits, see alignment E=3.5e-23 amino acids 156 to 290 (135 residues), 70.4 bits, see alignment E=9.5e-24

Best Hits

KEGG orthology group: None (inferred from 99% identity to dvl:Dvul_1141)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AA9 at UniProt or InterPro

Protein Sequence (306 amino acids)

>DVU2088 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNVRLRAYIHLTLAMCIAGSAVVAGKLMVSSMPVFLAAEAGLLASLAVQVPFTFMMKRER
IPADLSVHLYLVLQALFGVVLYRVFIFQGLQHTTATVGGVISSTTPLCIVLLSAIFLREH
ITRRTIAGAVCVVTGLATISLTPLMDATPAATGSFTGNVLILAAVVSESAFSVMSRAKRD
HLSPLARTAMVSVYAALCLLPFAIHDALHYDMATLDAETLSCIAYYGVFVSFLSYLLWFK
GVAVIAAGTAASFTGLIPLSSMGIAWLVLNETITSAHIAGLACVGAGIVIACIRPATSPT
TSSVAV