Protein Info for DVU2084 in Desulfovibrio vulgaris Hildenborough JW710

Name: appA
Annotation: oligopeptide-binding protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00496: SBP_bac_5" amino acids 104 to 465 (362 residues), 323.6 bits, see alignment E=8.8e-101

Best Hits

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 100% identity to dvu:DVU2084)

Predicted SEED Role

"Oligopeptide ABC transporter, periplasmic oligopeptide-binding protein OppA (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) or Sex pheromones in Enterococcus faecalis and other Firmicutes (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AB3 at UniProt or InterPro

Protein Sequence (565 amino acids)

>DVU2084 oligopeptide-binding protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSVLRCLTIVSLVAVCLCAGCGDDTAPTVSKEAPQVPSGSTAGEGFPPAGRPTAQEMAED
GGRIIMGSIGEPSNLISFLSSDASSHEVASQLYVGLLRYNRDLEIEPWAAESYEVLDGGR
LLRFKLRKGIRWQDGVELTADDVEFTYKLIIAPTTPTPYAGDFLAVQEFRKTGRYSFEVR
YDKPFARSLISWMQDIMPKHLLEGQDVRTTPFARKPVGAGPYMLESWEPGTRLVLRANPD
YFEGRPHIDEVVYRIIPDNATMFLELKAGKLDMMGLSPQQYLRQTDGYTWERDWRKYRYL
SFGYTYLGYNLKHPFFADARVRRAIAHAIDREGIIKGVLLGQGVPTVGPYKPGTWVYNDR
LTAYSYDPALAAEMLREAGWQDTDGDGILDREGRPFAFTILTNQGNDQRIKTATIIQSQL
KDVGIRVQIRTVEWAAFIKEFVNTGRFDAVILGWNITQDPDAYDVWHSSKAEPGGLNFVG
YRNAEVDAVLEKARRTFDQDERKQYYDRFQEIVHRDQPYCFLYVPYALPVVAARFRGIDP
APAGLMHNFNRWWVPVDQQRSTVQQ