Protein Info for DVU2077 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 PF13646: HEAT_2" amino acids 6 to 81 (76 residues), 28.8 bits, see alignment E=3.7e-10 amino acids 97 to 180 (84 residues), 46.4 bits, see alignment E=1.2e-15 amino acids 170 to 241 (72 residues), 35 bits, see alignment E=4.4e-12 amino acids 424 to 506 (83 residues), 34.6 bits, see alignment E=5.8e-12 amino acids 520 to 586 (67 residues), 35.2 bits, see alignment E=3.7e-12 PF02985: HEAT" amino acids 127 to 154 (28 residues), 18.1 bits, see alignment (E = 7.4e-07) amino acids 547 to 573 (27 residues), 17.9 bits, see alignment (E = 8.7e-07) PF03130: HEAT_PBS" amino acids 561 to 584 (24 residues), 17.6 bits, see alignment (E = 1.3e-06)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2077)

Predicted SEED Role

"FOG: HEAT repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AC0 at UniProt or InterPro

Protein Sequence (642 amino acids)

>DVU2077 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSEEQHILEVLQSDDAEQVREAAYSAGELRLEAAVPHLVRHLQSQNIGVQEAVDNALRKI
GGAAAVAGVIPLLRSDDAPIRNISMDILRDIGRDEFDALKQLLHDEDPDIRIFASDILGT
SGSILAVPALCEALLRDPEVNVRYQAAVSLGTLAFPEAADCLNKAMQDEEWVQFSVIEAL
IKIRAESSVNALVKALDTTSDLVASMIVDALGEMGNLKAVPLLLKRIEKSPTPLRNKIVR
AIVSILGKKSLSLLGEREQQRLGAYLLAALDDEDEEVQDAAMVGLASLGQAEATVAVLRL
AARLDPDRDHERLEAAIRCIGGIGFNEAVEEALSDENESTILMVVEAAADMNPAEIVPAL
KRIFWDKGRDAQRAIATQLARIASLEDVDFFLDLLERAEDAHVIKAALHFLGHRARPAGV
GERMLALLDHPYDDVKEAALEACIALQDVSLCASFRERFHSGDPLQRMMATYAMGRLDVD
GNLDVLREALVDDVPDVRKVALEALAGTCPITPEHLELVVPLMHDPVREVRLALVDLFGA
CPEESVIGHLLEALDDEDDWVRVRAIEALGRLGRKECVTPLIERVDGAGNLVLLKIIEAL
GSIGGNMAFRALLALMEHEDPEIQQAAEDAVARLGEQDSEGE