Protein Info for DVU2071 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 128 to 152 (25 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2071)

Predicted SEED Role

"FIG00602277: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AC6 at UniProt or InterPro

Protein Sequence (318 amino acids)

>DVU2071 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHSLLPDATTWALALSGGLLLTLMAAATGLPFMALAGQTLATARRRVFYDKCARQLAMLV
AVLSPLSLLLTGISVLRAVQMEPDMLAGPYRMPVVALLALHAGTTLCAVLYFVTWKGLAS
RLPLLHRLFGLSAGIGGAKTLFVALAIVRALFVAGHPLPATGSALEVMLALLLPAGNALL
WPAFGLALCAAAAFGGVYGTQWLVLRRQQDDFGRDHYNFTLPWCAAWGMYGTVVMLAPLG
YVLWRALSQVSPTFGVLPPLVPFALCIIAPLLCLTCSMAVTRSATPMRLKPAITVAVLAA
IAGTAGVLSTLLSLSRIG