Protein Info for DVU2070 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: TPR domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02795: tol-pal system protein YbgF" amino acids 138 to 253 (116 residues), 121 bits, see alignment E=2.1e-39 PF13174: TPR_6" amino acids 139 to 169 (31 residues), 19.9 bits, see alignment 2.2e-07 amino acids 176 to 206 (31 residues), 19 bits, see alignment 4.2e-07 amino acids 212 to 243 (32 residues), 23.3 bits, see alignment 1.9e-08 PF13432: TPR_16" amino acids 141 to 206 (66 residues), 46.8 bits, see alignment E=7.8e-16 PF07719: TPR_2" amino acids 174 to 207 (34 residues), 24.3 bits, see alignment 6e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1158)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AC7 at UniProt or InterPro

Protein Sequence (257 amino acids)

>DVU2070 TPR domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTQGRYVGALGLLLVCACAGCAGQSATDVRLRGLEERTAALERSVAVRDAQVTSLDERTS
ATDATVDDLRERVGRLEAEGRATVVSEREAAGTMGGRKVYPATSRPSSKASSTKPVARAV
SATRPAAKPVATAAGGASAAYKEALALLERGRPEEARQRFDAFIEAYPSDALQPNAHYWR
GEALYAQRRYADAIIDFKDVVASYPKHQKASDSLLKAGMAYQRLNDEENARLQFKALQEQ
YPATPAAVLARKRGMLP