Protein Info for DVU2066 in Desulfovibrio vulgaris Hildenborough JW710

Name: xerC
Annotation: site-specific recombinase, phage integrase family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF02899: Phage_int_SAM_1" amino acids 46 to 129 (84 residues), 63.6 bits, see alignment E=2.5e-21 PF13495: Phage_int_SAM_4" amino acids 48 to 129 (82 residues), 30.3 bits, see alignment E=6.7e-11 PF00589: Phage_integrase" amino acids 256 to 407 (152 residues), 147.8 bits, see alignment E=4.3e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2066)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AD1 at UniProt or InterPro

Protein Sequence (474 amino acids)

>DVU2066 site-specific recombinase, phage integrase family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAKLTDRGRATARGPRSAARGRGGASFSQSDGDSATGGDAAVPETLELFLAHVELEKGYS
PATVTAYGTDLMQFHGVLTAEGFGLDAPEDVTRRHVQRYLAELHRLRTARSSVARKLSAL
RAFFRYMLRLRRVTADPVAAVHNPRQEKRQPRTLNVDQVFALLDTGHGPATGAPDGDCDA
GVATRKSMGNTVDDAVCGHGSGSLVSGHHDAPRGTVSGAGADAGAAAVPTLPAGSTSRKP
LSTAVESMSGDTLHAEAIRRRDLALAELLYGSGLRISEALGLDVLDADPSAGVVRVLGKG
SKERMSPLSDTSVDALREWLHFRHHLASEGERALFVGARGDRLDRRQATRIIDALCRRAG
LPQSVSPHGLRHSFATHLLEAGADLRSVQELLGHARLATTQRYTHLTLAHLIEVYDKAHP
RASLGVSQYAAPKPESVPILASEPLSGPTSSASSREDSERRQPSRSRARKKSHG