Protein Info for DVU2003 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: transposase, IS5 family, truncation (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 352 to 371 (20 residues), see Phobius details amino acids 377 to 400 (24 residues), see Phobius details PF05598: DUF772" amino acids 12 to 88 (77 residues), 74.4 bits, see alignment E=1.4e-24 PF01609: DDE_Tnp_1" amino acids 191 to 357 (167 residues), 48.7 bits, see alignment E=1.2e-16 PF13751: DDE_Tnp_1_6" amino acids 295 to 362 (68 residues), 31.8 bits, see alignment E=2.3e-11

Best Hits

KEGG orthology group: K07487, transposase (inferred from 100% identity to dvu:DVU2003)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AJ0 at UniProt or InterPro

Protein Sequence (420 amino acids)

>DVU2003 transposase, IS5 family, truncation (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQSVLIKGGFDRFVEKVCEPYYASGPGRKSIPPGRYFRMHLVGYFEGIESERGLEWRCSD
SLSLRKFLRLSLTQRVPDHSSLSRIRQRLPLEVHQEVFGWVLQALTKSGLVVGERLGIDA
STMEANAAMRSIVRRDTGETYQQMLERIAKDSGIKTPTREELARMDRKRKGKKLSNKDWK
SEIDEDARITKMKDSRTHLAYKPEHAVDLDTGAIVSADIHKADQGDTTTIGKTLESARKN
LSDIGCTPITTAPTEVIADKGYHSREVVKELDGGVWRTRIAVPKANGLLNWKGDHEARRA
VYNNRARLKSAKGRELAKRRTELVERSFQHVLDRGGMRRTHLRGQENVHKRYLLCVAGFN
LGLLMRQLIGFGTPKGYFYLNSAQIFIIVWGRMVVSIILVEMKSETGQEFVGTQIAVERC