Protein Info for DVU1988 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details PF04474: DUF554" amino acids 5 to 223 (219 residues), 265.2 bits, see alignment E=2.1e-83

Best Hits

KEGG orthology group: K07150, (no description) (inferred from 100% identity to dvu:DVU1988)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AK4 at UniProt or InterPro

Protein Sequence (228 amino acids)

>DVU1988 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MILPLGSLVNAAAVVGGGFIGLLLGARLPDRVRAIVFQGLGLCTMVIGMQMAFKTANPLI
MIFSILGGAVTGELMRLEDLFVKGGEALKARLKSSNPRFTEGLVNATVLFCIGSMAILGP
FDEGLRGDRTIVLTKSILDGFASVALASAMGVGVLFAAVPLLLYQGGLTLFAGTLQPYLG
PVVMNELTATGGVLILGIGINLLELKRIPLSNMLPALVYAVVLARIFG