Protein Info for DVU1958 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 865 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 169 to 190 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 221 to 337 (117 residues), 23 bits, see alignment E=3.7e-09 PF08448: PAS_4" amino acids 352 to 457 (106 residues), 33.1 bits, see alignment E=1.7e-11 amino acids 493 to 601 (109 residues), 34.2 bits, see alignment E=7.7e-12 PF00512: HisKA" amino acids 617 to 705 (89 residues), 30.2 bits, see alignment E=1.2e-10 PF02518: HATPase_c" amino acids 756 to 865 (110 residues), 78.4 bits, see alignment E=1.7e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1958)

Predicted SEED Role

"sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AN4 at UniProt or InterPro

Protein Sequence (865 amino acids)

>DVU1958 sensory box histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNAGRASAILLTLGVAVTLVLALAAYHRYDNELQTTQRRLSAIVTSAAELHAHQDAHTAV
AHLAETVTRTGYALFMVDAKTYRASSSPEGMYGVQGPPPLSPRPPLSETVLARLQHSLKP
GTGTTVIDVTAANGTAGAPTLFSCTALTQDDLLICATADMTGTTDSFHMSLFTAVFATLL
LTGGALYTLTAWHGRVRKRLAELKDTIATLQGQNNACATTAARFAALFDLAEEAMYVMAG
GHIVKYNQTFANMIRGGNTPGSDDGILHAVHPDDSLYVSRIQAMRQRGEPTPTRIVFRLR
DTGQGVRWVQCTSSVIPWDEGRAHLSVLSDITDFKQSTLLVEQREQALLRVVEQLPYALA
VLAPDGSILQTNGAWRDLMHTYTAPGMTAASIFENPLVMQNGHENAVQEALTGAPVETEA
HPVPSVHGEARRWLRLRFSPVRDHHDRLQSIIALYSDETPHVMDTLQLSELQHEITRLHE
TSSAAHGRLHAVLDALPWAIVTVDGAGRVTFINGRAAVFADTDAEAVHGLTVEALPPVLA
RYAPMLRASLRSGTPQPSIRNEEYISGRMRHLEAASYPIDAGGQEADKAAFLCIEDVTER
VALEDMMVQSEKMVSVGALAAGMAHEINNPLGAILQGVQNLRRRLTADLPANVNATSEVG
LTMEQLRAYVESRQIPMLLDGIREAGERAGRIVSHMLTFSRRSQGLHRPAHLGPLIDKAL
ELVETDYDLLKAYDFKQIEVFRDEEPDLPPFNCSSSEIEQVILNLLKNAAHAVSVRTDDA
PPRIRITTRSEENGIRLEIADNGPGMTAEQRRRAFEPFFTTREVGMGTGLGLSICYFIIT
TKHRGTIAIDAAPEGGVQFTIRLPF