Protein Info for DVU1953 in Desulfovibrio vulgaris Hildenborough JW710

Name: proA
Annotation: gamma-glutamyl phosphate reductase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to PROA_DESVH: Gamma-glutamyl phosphate reductase (proA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 100% identity to dvl:Dvul_1215)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
L-ornithine biosynthesis II (2/3 steps found)
L-citrulline biosynthesis (5/8 steps found)
superpathway of L-citrulline metabolism (7/12 steps found)
L-N^δ-acetylornithine biosynthesis (3/7 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AN9 at UniProt or InterPro

Protein Sequence (419 amino acids)

>DVU1953 gamma-glutamyl phosphate reductase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNIASQIEDMGRRARAAGRRLAAASPAAKAGALDHLATLLEQRQDAILAANAADLAAAAE
AGMDAPRMDRLRLTPATIAEMAAACRHVAALPDPVGAIETQWQRPNGLLVGKMRIPLGVI
AMIYESRPNVTIDSAILCLKAGNAVILRGGSEAIHSNLALAALITEALSSVGLPAEAVQV
VSTTDRAVIAELCKLEEHIDVIIPRGGETLIRAVVDMARMPVLKHYKGVCHAYIDSGADL
AQAVEIIHNAKVQRPGVCNALEGLLVHRDEAAAFLPAIAERLGNDGVEFRACPASLPLLG
DSAIPMKDEDNGQEFHDLILLVRIVDDMDEALAHIAAYGSNHTEIICTRDHGNAMRFLRE
ADASMVAVNASSRFNDGGQLGLGAEIGISTSKLHSYGPMGVQELTTTKFVVFGAGQIRQ