Protein Info for DVU1950 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: indolepyruvate ferredoxin oxidoreductase, beta subunit, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01558: POR
  • amino acids 12 to 192 (181 residues), 127.3 bits, E=3.8e-41

Best Hits

Swiss-Prot: 38% identical to IORB_METTM: Indolepyruvate oxidoreductase subunit IorB (iorB) from Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)

KEGG orthology group: K00180, indolepyruvate ferredoxin oxidoreductase, beta subunit [EC: 1.2.7.8] (inferred from 100% identity to dvl:Dvul_1218)

Predicted SEED Role

"Indolepyruvate oxidoreductase subunit IorB (EC 1.2.7.8)" in subsystem Aromatic amino acid interconversions with aryl acids (EC 1.2.7.8)

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.8

Use Curated BLAST to search for 1.2.7.8

Sequence Analysis Tools

See Q72AP2 at UniProt or InterPro

Protein Sequence (198 amino acids)

>DVU1950 indolepyruvate ferredoxin oxidoreductase, beta subunit, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSRIRIYMTGVGGQGTLTATTLLARTALDAGCEVVAGEIHGMAQRGGVVESTVLLGGWQS
PKLSHGEADIVLGFEPLETLRGLPYLTAGGAVLSNAETLPPVGVSMGRESYPCLDGIREK
VTGCSGRAWFLPCRTLGLKAGSVQSGNSVLLGALCATGLLPFGVDALEAAIRRHLAPKLV
DMNLRAVELGVQAVADAS