Protein Info for DVU1949 in Desulfovibrio vulgaris Hildenborough JW710

Name: nifA-1
Annotation: nif-specific regulatory protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 PF01590: GAF" amino acids 33 to 175 (143 residues), 45.3 bits, see alignment E=5.7e-15 PF00158: Sigma54_activat" amino acids 211 to 376 (166 residues), 229.3 bits, see alignment E=1e-71 PF14532: Sigma54_activ_2" amino acids 216 to 381 (166 residues), 50.4 bits, see alignment E=1.4e-16 PF07728: AAA_5" amino acids 235 to 351 (117 residues), 26.2 bits, see alignment E=3.1e-09 PF00004: AAA" amino acids 235 to 353 (119 residues), 26.9 bits, see alignment E=2.7e-09 PF25601: AAA_lid_14" amino acids 382 to 464 (83 residues), 102.2 bits, see alignment E=5e-33 PF02954: HTH_8" amino acids 473 to 513 (41 residues), 31.3 bits, see alignment 6.4e-11

Best Hits

KEGG orthology group: K02584, Nif-specific regulatory protein (inferred from 100% identity to dvl:Dvul_1219)

Predicted SEED Role

"Nitrogenase (molybdenum-iron)-specific transcriptional regulator NifA" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AP3 at UniProt or InterPro

Protein Sequence (529 amino acids)

>DVU1949 nif-specific regulatory protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTQSIQTDDRRLQPYLGTLQKIVSEMGPQRPFQSTLKSLLHTLAENHDFKRPHIVIFDPE
TRTLKLSLTDTPAKAQNAEYEPGVGVTGQVFASGQPVVVPCMKEHPAFLNKMFGRSEEEL
ATLAFICVPVLGPSDEPREGREVIGTLSVDTPNTSHAQLEAHCRFLEVVAGMIANHAAYM
QEEMARQKHLMTQGLIVGDTGEGTFNPANIVVASKTMRLVLNQAAQVGPSRATALLRGES
GTGKELLAEAIHQASPRRDMPLIKLNCAALPSELVESELFGYQKGAFTGAIQTKKGLFEL
AHKGTLFLDEVGELSPSAQAKVLRAIQEQEIQRLGSEQTILVDVRLICATHQPLEELVEK
GLFREDLYYRINVFPIFIPPLRERREDILPIAEHFLRMYAEEYSKSIKRISTPAIDLLTQ
YHWPGNIRELKNCIERAVLVCDEQVIRTYHMPPSLQTAESTATDTNLSFCEAVAKFEQEL
LVDALKKARGNMLQAARDLRVSYRIVNYKVKKYGLDAKKFAVAKARGMK