Protein Info for DVU1947 in Desulfovibrio vulgaris Hildenborough JW710

Name: oorC
Annotation: pyruvate ferredoxin oxidoreductase, gamma subunit, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 39% identical to KORC_METTH: 2-oxoglutarate synthase subunit KorC (korC) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K00177, 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [EC: 1.2.7.3] (inferred from 100% identity to dvl:Dvul_1221)

Predicted SEED Role

"2-oxoglutarate oxidoreductase, gamma subunit (EC 1.2.7.3)" (EC 1.2.7.3)

MetaCyc Pathways

reductive TCA cycle I (9/11 steps found)
incomplete reductive TCA cycle (6/7 steps found)
TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
TCA cycle VI (Helicobacter) (7/9 steps found)
TCA cycle VII (acetate-producers) (6/9 steps found)
reductive TCA cycle II (7/12 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.3

Use Curated BLAST to search for 1.2.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AP5 at UniProt or InterPro

Protein Sequence (207 amino acids)

>DVU1947 pyruvate ferredoxin oxidoreductase, gamma subunit, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKKPQEIKRFEIRLSGFGGQGLITLGRLLGSALALGHGYYVTQTQSYGPEARGGSSRADL
VVSSQPISYPKTEQLDLLVALSQEACNGYYPYLKRTGLLVVDTTLVKHTPTNVFLGLPFT
QMARDQIGNPLTINTLVMGAVSHLLDFADVKLMRKGLEANMPAKIVDVNVKAFTLGLKQA
KKHFGDAHGLWAAAEVNGSAEVETDHE