Protein Info for DVU1919 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: hydrogenase expression/formation protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00072: hydrogenase maturation protease" amino acids 5 to 149 (145 residues), 129.2 bits, see alignment E=6.2e-42 PF01750: HycI" amino acids 25 to 145 (121 residues), 81 bits, see alignment E=3.7e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1919)

Predicted SEED Role

"Hydrogenase maturation protease (EC 3.4.24.-)" in subsystem Membrane-bound Ni, Fe-hydrogenase (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AS2 at UniProt or InterPro

Protein Sequence (156 amino acids)

>DVU1919 hydrogenase expression/formation protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKKLLVLGIGNMLLTDDGVGVFAAQELMKETWPDNVNIMEAGTFTQDIFYLFEGYDALLV
LDIIHTGAEPGTIYRLSEEDLVQKESQRLSIHDIDLIDSLRMAEMLGGKKPTMHVLGMEP
FDYTTWNIGLSAPLSERYPAFLQLAREEIQAILASF