Protein Info for DVU1913 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: aspartate kinase, monofunctional class (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR00656: aspartate kinase, monofunctional class" amino acids 1 to 402 (402 residues), 433.9 bits, see alignment E=6.1e-134 TIGR00657: aspartate kinase" amino acids 1 to 401 (401 residues), 427.8 bits, see alignment E=5.6e-132 PF00696: AA_kinase" amino acids 3 to 230 (228 residues), 171.3 bits, see alignment E=6e-54 PF01842: ACT" amino acids 266 to 322 (57 residues), 39.6 bits, see alignment 7e-14 PF22468: ACT_9" amino acids 269 to 318 (50 residues), 29.1 bits, see alignment 1.3e-10 amino acids 342 to 400 (59 residues), 85 bits, see alignment E=4.7e-28 PF13840: ACT_7" amino acids 339 to 398 (60 residues), 60.1 bits, see alignment E=3e-20

Best Hits

Swiss-Prot: 56% identical to AK_PSEPK: Aspartate kinase (PP_4473) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 100% identity to dvl:Dvul_1251)

MetaCyc: 43% identical to aspartokinase beta subunit (Corynebacterium glutamicum ATCC 13032)
Aspartate kinase. [EC: 2.7.2.4]

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AS8 at UniProt or InterPro

Protein Sequence (408 amino acids)

>DVU1913 aspartate kinase, monofunctional class (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRILVQKFGGTSVANLECMKQVRAKVLAARERGYKVVVVLSAMSGETNRLLALADEWSSE
PDPAETDALVVTGEQVSIALFSMLLKDSGIKARSFLGFQIPIVTSDTFGSARILSIDDSR
LRAELETHDVLVVAGFQGCTADGRLTTLGRGGSDTSAVALAAALGSVECEIYTDVDGVYT
TDPNLCSTARKLDRITYDEMLEMASMGAKVLQIRSVEFAKKYNVPVHVRSTFTDTTGTLV
TQEDSSMEAVLVSGIAYDKDQARITLRSVPDRPGVAAAIFVPLSTNGVVVDMIVQNPSRE
GVTDMTFTVPRKDLKKTLTLMEGIREETEALEVLHDVSVAKVSAIGVGMRNHSGVAAKAF
AALRKENINILMISTSEIKITCLIEEKYTELAVRVLHDAFGLSSNTEH