Protein Info for DVU1910 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: YjeF-related protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 PF03853: YjeF_N" amino acids 27 to 255 (229 residues), 121 bits, see alignment E=5.3e-39 TIGR00196: YjeF family C-terminal domain" amino acids 288 to 567 (280 residues), 183.7 bits, see alignment E=4.7e-58 PF01256: Carb_kinase" amino acids 312 to 566 (255 residues), 148.9 bits, see alignment E=1.8e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1910)

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AT1 at UniProt or InterPro

Protein Sequence (574 amino acids)

>DVU1910 YjeF-related protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MFTPLPTPEEMSAWDAATIRLGLPAMVLMENAAREALDVLRTSCGPLRHRRVILFMGGGN
NGGDAAAVARGLHDLGACTLLVHTRPLRAYRGETAAHLRLALRCGVPAIDASSWLKLAVR
ANAPFAPWHNAMAAARKQKAQTAHDGAQGNPPARLYGTVQDDTAPAPPRRRDATIDYTQA
PLPPVIVDGLLGTGLRGPVRERERALIRAINALRDEGAHVFSLDIPSGVDGLTGRPAPEA
VHAHVTVTFEAPKTGIVLPEARCHVGALHVRPIGIPRTVRSTPTRFRLMTDDCTKVMPVP
RDDMHKGTAGHVLIIGGSPGLTGAPHLAARAALRGGAGFATIATPGSLATEAKCASPDVM
TLPLGVAATWPDTPDEALMSLIRRCSVLVVGPGMGRTPQAAAFASRLLAVRHRPPAIVDA
DALHALATGGIALDLIAETDIVTPHPGEAALLLGWETADIQRDRPAALAALMSRLHCTVI
LKGACTLTGSPGLPVTVSPRMASTLAVAGSGDVLAGLAGALVAQGATSPIAACLSVNIHG
KAGEMLLEGHPQRGCLASDIADALPRARKELCHA