Protein Info for DVU1907 in Desulfovibrio vulgaris Hildenborough JW710

Name: ugd
Annotation: UDP-glucose 6-dehydrogenase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR03026: nucleotide sugar dehydrogenase" amino acids 1 to 422 (422 residues), 460 bits, see alignment E=3.4e-142 PF03721: UDPG_MGDP_dh_N" amino acids 1 to 187 (187 residues), 211.3 bits, see alignment E=1.4e-66 PF00984: UDPG_MGDP_dh" amino acids 204 to 296 (93 residues), 134 bits, see alignment E=2.4e-43 PF03720: UDPG_MGDP_dh_C" amino acids 322 to 425 (104 residues), 102.8 bits, see alignment E=1.8e-33

Best Hits

Swiss-Prot: 36% identical to ALGD_PSEAE: GDP-mannose 6-dehydrogenase (algD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 100% identity to dvl:Dvul_1257)

MetaCyc: 36% identical to GDP-mannose 6-dehydrogenase (Pseudomonas aeruginosa)
GDP-mannose 6-dehydrogenase. [EC: 1.1.1.132]

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.132 or 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AT3 at UniProt or InterPro

Protein Sequence (445 amino acids)

>DVU1907 UDP-glucose 6-dehydrogenase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKVCIVGTGYVGLVSAACFAEMGNDVRCVDVNPEVVATLRAGKVHIYEPGLETLVQRNYA
DGRLTFTTNLAEGLAGAQFAFITVGTPSRDDGSCDLCFVEEVARQIGRHMQAPLIVVDKS
TVPVGTADRVRSLIAEELASRGADIAFDVVSNPEFLKEGDAVSDFMKPDRVIVGTDSERT
AEKLKELYAPFARSRDKLIVMSIRSAEMTKYAANCMLATKISFINEIAGICEKVGADVRD
VRVGIGSDHRIGYHFIYPGVGYGGSCFPKDVKALIHTAHDADFKPELLEAVESVNARQKR
SMAKRIAAYFEPQGGVAGKTLALWGLAFKANTDDMREAASLSVIEELTALGMRVRAYDPV
AADNARRLLEGNDLVEIVGDQYAACEGAQALLVITEWNQFRNPDFDRVKASLTAPILFDG
RNLYAPRNMAEAGFAYFCVGRKDVV