Protein Info for DVU1904 in Desulfovibrio vulgaris Hildenborough JW710

Name: cheW-2
Annotation: chemotaxis protein CheW (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF01584: CheW" amino acids 14 to 149 (136 residues), 154.6 bits, see alignment E=6.5e-50

Best Hits

Swiss-Prot: 41% identical to CHEW_KLEAK: Chemotaxis protein CheW (cheW) from Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006)

KEGG orthology group: K03408, purine-binding chemotaxis protein CheW (inferred from 100% identity to dvu:DVU1904)

Predicted SEED Role

"Positive regulator of CheA protein activity (CheW)" in subsystem Bacterial Chemotaxis or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AT6 at UniProt or InterPro

Protein Sequence (158 amino acids)

>DVU1904 chemotaxis protein CheW (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEATQKRQDDELLQLVTFSIGEEEFGVDILKVQEIIRTMEITKVPRAPEFVEGVINLRGK
VIPIIDLRRRFGLDSKTHDKHTRIIVIEINNMIVGFVVDSVSEVLRIPASTVEPPPPVVA
GLESEYISGVGKLQDRLLILLDLDRLLSNDDIGAISQL