Protein Info for DVU1901 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: peptidyl-prolyl cis-trans isomerase domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13624: SurA_N_3" amino acids 9 to 145 (137 residues), 58.5 bits, see alignment E=2.3e-19 PF13623: SurA_N_2" amino acids 21 to 112 (92 residues), 40.2 bits, see alignment E=9.4e-14 PF09312: SurA_N" amino acids 26 to 145 (120 residues), 56.2 bits, see alignment E=1.1e-18 PF13145: Rotamase_2" amino acids 156 to 278 (123 residues), 57.5 bits, see alignment E=7e-19 PF00639: Rotamase" amino acids 189 to 253 (65 residues), 31.1 bits, see alignment E=1.2e-10 PF13616: Rotamase_3" amino acids 190 to 252 (63 residues), 23.6 bits, see alignment E=2e-08

Best Hits

KEGG orthology group: K03771, peptidyl-prolyl cis-trans isomerase SurA [EC: 5.2.1.8] (inferred from 100% identity to dvu:DVU1901)

Predicted SEED Role

"Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AT9 at UniProt or InterPro

Protein Sequence (311 amino acids)

>DVU1901 peptidyl-prolyl cis-trans isomerase domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
LSSIRSLLLAALVLCLSATGAAADSLNRIAAVVNGEMITYFDVQAQAAPEILRAGLDPVR
DADAEPVRRITRNVLDSMISDILISQEAERLKITVQDSEVDNEYRKIVQRSQLAPEQFER
QLAQQGLSADLMRERIRRGILRHRLLGLMIARKVVVTRDEIAKYYEAHKGQFVSGRKVRL
GLVIFPPRDDADALAAQVKSGAMTFADLAARHSIGPNPQNGGVIGDLLWSDLSMEWRDTL
SELKPGDVSRVFLVEGRKAVLQLVASNEGKGQALDDVAEEIENILREPKMQERLQEYIGQ
LRSRAVIDIRI