Protein Info for DVU1895 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: major facilitator superfamily protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 299 to 324 (26 residues), see Phobius details amino acids 337 to 360 (24 residues), see Phobius details amino acids 366 to 384 (19 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 237 (220 residues), 140.9 bits, see alignment E=1e-44 amino acids 232 to 381 (150 residues), 57.4 bits, see alignment E=2.5e-19 PF12832: MFS_1_like" amino acids 28 to 367 (340 residues), 27.9 bits, see alignment E=2.5e-10 PF05977: MFS_3" amino acids 47 to 308 (262 residues), 53.3 bits, see alignment E=3.3e-18 PF00083: Sugar_tr" amino acids 48 to 188 (141 residues), 29 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1268)

Predicted SEED Role

"major facilitator superfamily protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AU5 at UniProt or InterPro

Protein Sequence (388 amino acids)

>DVU1895 major facilitator superfamily protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPEKAPTLRIGRHLLLVFGITLMVVMGVSSIMPILPDLARTFDMPMSSVGMVFMAFTLPG
VVLTPLGGILADRIGRKKVLIPSLLLFAAGGVACAFAPSLPVLLACRFVQGIGAAPLGVL
YTTIIGDLYDGNQRMQAMGFNAGVLSLGTAIYPAVGGLLGELGWRVPFLLPLLALPLCFA
IARTTFPEPRSSQGMGEYFRSTWGIISSPRAITLFLLTLFTFLILYGPMVTFFPVLADQQ
FHATPSQIGFVFSIASAGTVLTAVRLGTLARLIRPVRLLLASHGLYALAMVTMPFVPSLW
WALAPVFIFGLAQGLNIPNTATLLTDLAPMEGRAAIMAVNGTVLRLAQTIGPVLAGIAFA
TGGLSGVYTFGAFMAASMAALILARGLR