Protein Info for DVU1867 in Desulfovibrio vulgaris Hildenborough JW710

Name: dapF
Annotation: diaminopimelate epimerase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 TIGR00652: diaminopimelate epimerase" amino acids 10 to 272 (263 residues), 241.1 bits, see alignment E=7.3e-76 PF01678: DAP_epimerase" amino acids 10 to 115 (106 residues), 69.5 bits, see alignment E=1.4e-23 amino acids 151 to 266 (116 residues), 72.9 bits, see alignment E=1.2e-24

Best Hits

Swiss-Prot: 43% identical to DAPF_AQUAE: Diaminopimelate epimerase (dapF) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 100% identity to dvl:Dvul_1297)

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.7

Use Curated BLAST to search for 5.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AX3 at UniProt or InterPro

Protein Sequence (282 amino acids)

>DVU1867 diaminopimelate epimerase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSGKKATVPFHKLHGCGNDFVFIDNRHLKLSVEAMPDWARSICRRAFGVGADGLVFLDTA
PQGHEADYIWHFYNADGSRAEMCGNASRCAAVLAVDLGFAGPRHAFGTDAGIVHAVADVE
AGYAKVELTRPRDLAAGTTLELEGTPFTVHFVNTGVPHAVVFSDSVDGLDLRRLGAALRY
HPHFSPAGTNANFASIIDRRTIHLRTYERGVEDETYACGTGAAATAFIAHTLGLTDASVG
VRTSGGEVLGIDIEDGSIFLSGKAVRVFSGEMHPEGLGLTLP