Protein Info for DVU1847 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF10609: ParA" amino acids 36 to 281 (246 residues), 315.3 bits, see alignment E=6.7e-98 PF02374: ArsA_ATPase" amino acids 39 to 75 (37 residues), 24.3 bits, see alignment 4.5e-09 PF01656: CbiA" amino acids 41 to 260 (220 residues), 43.3 bits, see alignment E=8.4e-15 PF13614: AAA_31" amino acids 42 to 201 (160 residues), 33.4 bits, see alignment E=1e-11 PF09140: MipZ" amino acids 44 to 175 (132 residues), 31.2 bits, see alignment E=3.7e-11

Best Hits

Swiss-Prot: 47% identical to APBC_SACS2: Iron-sulfur cluster carrier protein (SSO0460) from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1315)

Predicted SEED Role

"Cytosolic Fe-S cluster assembling factor NBP35"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AZ3 at UniProt or InterPro

Protein Sequence (297 amino acids)

>DVU1847 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSSCSSCSSGRKGGEGGVDAATAIQDQLISSTLGRIKYKLFIMSGKGGVGKSSVTVNTAA
ALAARGFKVGILDVDIHGPSVPNLLGLHATLEADERGGLINPAKCNENLYVVSMDSLLRD
RDTAVLWRGPKKTAAIRQFVADVNWGDLDFLLIDSPPGTGDEHMTVLKTIPDALCVVVTT
PQEISLADVRKAINFLQYAQANVLGVVENMSGLCCPHCGKEINLFKKGGGRELAEKYALP
FLGAIPLDPATVVAADTGVPVVLLEGDSHAKQGFLALADNIAAAVGNSLEAISSSHA