Protein Info for DVU1838 in Desulfovibrio vulgaris Hildenborough JW710

Name: trxB-2
Annotation: thioredoxin reductase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF01494: FAD_binding_3" amino acids 5 to 36 (32 residues), 30.2 bits, see alignment 1.4e-10 PF01134: GIDA" amino acids 5 to 32 (28 residues), 24.9 bits, see alignment (E = 5.1e-09) PF00890: FAD_binding_2" amino acids 5 to 39 (35 residues), 28.8 bits, see alignment 3.8e-10 PF12831: FAD_oxidored" amino acids 5 to 40 (36 residues), 28.7 bits, see alignment 4.2e-10 PF07992: Pyr_redox_2" amino acids 5 to 291 (287 residues), 152.6 bits, see alignment E=8.2e-48 PF13450: NAD_binding_8" amino acids 8 to 41 (34 residues), 25.9 bits, see alignment 4.9e-09 PF13738: Pyr_redox_3" amino acids 79 to 274 (196 residues), 39.8 bits, see alignment E=1.7e-13 PF00070: Pyr_redox" amino acids 146 to 217 (72 residues), 40.2 bits, see alignment E=2e-13

Best Hits

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 100% identity to dvl:Dvul_1324)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B02 at UniProt or InterPro

Protein Sequence (307 amino acids)

>DVU1838 thioredoxin reductase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQQFDAIVIGGGPAGMTAALYLARSGVSVAMVERLSPGGQVLMTSEIENYPGFPKGIQGW
ELADLFAAHLEGYAITRFNDEVREIVPAPADNRVRVGDDWISGRTLILCSGARYKRLGLP
DEERLTGKGVSYCALCDGNFFRGQVVGVVGGGNSALEESLYLSKLVKKLHLIHRRDDFRA
AKCYQDKVCIMPDIDVVRSSVVEAIHGDDRLTGVTVRNVKTGETSFLELDGLFIFIGFEP
VGGFLPGGIERDEQGFVITDGEMRTNLPGIFAAGDIRSKMCRQVTTAVGDGATAANAAFV
YLEQLDA