Protein Info for DVU1837 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: competence protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 24 to 255 (232 residues), 209.8 bits, see alignment E=2.1e-66 PF13512: TPR_18" amino acids 49 to 178 (130 residues), 65.4 bits, see alignment E=9.8e-22 PF13525: YfiO" amino acids 50 to 224 (175 residues), 121.5 bits, see alignment E=6.2e-39 PF13174: TPR_6" amino acids 63 to 86 (24 residues), 12.3 bits, see alignment (E = 3.5e-05) amino acids 128 to 167 (40 residues), 16.2 bits, see alignment 2.1e-06

Best Hits

Swiss-Prot: 100% identical to BAMD_DESVH: Outer membrane protein assembly factor BamD (bamD) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K05807, putative lipoprotein (inferred from 100% identity to dvu:DVU1837)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B03 at UniProt or InterPro

Protein Sequence (260 amino acids)

>DVU1837 competence protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTAQRRPTPHSSIWNSSMRKTLLRAACMAALTFMLSGCGIIDYFYLPPPEDTAQELYESG
NDAMREKDYVAAAQAYTRLKDNYPFSPYTIEAELSLADAYFLDEEYPAAAEAYKEFETLH
PRHQAIPYVLYQVGMARLKSFISVDRPVNNVQEAYQYFQRLRESYPGTEYAAKAEEHMKE
CRRLLAERELFIADVYWRTGKYGAAWQRYSFVRDNFKDVPHAVEYATEKANVAYLRHREA
QSENIREAREGSWKQWFKWL