Protein Info for DVU1825 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: amidohydrolase family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 PF01979: Amidohydro_1" amino acids 62 to 408 (347 residues), 234.5 bits, see alignment E=2.1e-73 PF07969: Amidohydro_3" amino acids 198 to 410 (213 residues), 55.1 bits, see alignment E=1e-18

Best Hits

Swiss-Prot: 100% identical to MTAD_DESVH: 5-methylthioadenosine/S-adenosylhomocysteine deaminase (mtaD) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K12960, 5-methylthioadenosine/S-adenosylhomocysteine deaminase [EC: 3.5.4.- 3.5.4.28] (inferred from 100% identity to dvu:DVU1825)

Predicted SEED Role

"S-adenosylhomocysteine deaminase (EC 3.5.4.28); Methylthioadenosine deaminase" (EC 3.5.4.28)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.- or 3.5.4.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B14 at UniProt or InterPro

Protein Sequence (442 amino acids)

>DVU1825 amidohydrolase family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPLPCDTILQAALIVTQDDARTVIEDGAIAIHEGRIAAVGQRDAIVGNWHGVTVIDMGES
LIMPGLVNAHTHASMTLLRGLADDLPLMDWLTGHIFPVEKGLTGELVELGALLGCAEMLR
TGTTAFSDMYLIEDATLRAVDRAGLRCLAGEAIFAFPSPAYADPETAFDLVRAQHDRWKH
HARAALAVAPHAVYTSTPAILARCRDLAEELGLPIHLHLAETATETAQCIEQHGARPVPY
CDGLGLLTPRTTLAHCVDLTEGEIDLLAERGVTVAHCPESNMKLASGIAPATAMLGRGMT
LGLGTDGAASNNSLNMFTEMTSCALLHKVHHMDPTCAPASAVLDMATRGGAHALHMQGIG
RIEAGCPADIIALDLRAPNMQPIFNPASHLVYAATGHETRLTMVGGEVLYLDGCYTRFDM
DDLLKEVRKARTWAMEQVRAAR